Loading...
Statistics

Thảo Nguyên Xanh GROUP
www.thaonguyenxanh.vn/
Advertisement

Thaonguyenxanh.vn

Home Conversion Technology Metas Server
Thaonguyenxanh.vn is hosted in Vietnam / Hanoi . Thaonguyenxanh.vn uses HTTPS protocol. Number of used technologies: 8. First technologies: CSS, Google Font API, Html, Number of used javascripts: 7. First javascripts: Jquery.min.js, Superfish-compile.js, Jquery.colorbox-min.js, Number of used analytics tools: 0. Number of used plugins, modules: 0. Its server type is: Vinahost. Its CMS is: DrupalWordpress.

Technologies in use by Thaonguyenxanh.vn

Technology

Number of occurences: 8
  • CSS
  • Google Font API
  • Html
  • Javascript
  • jQuery Colorbox
  • jQuery UI
  • Php
  • Pingback

Advertisement

Javascripts

Number of occurences: 7
  • jquery.min.js
  • superfish-compile.js
  • jquery.colorbox-min.js
  • jquery-ui-1.8.13.custom.min.js
  • jquery.tipTip.minified.js
  • p2.js
  • supersized.3.1.3.core.min.js

Content Management System

Number of occurences: 2
  • Drupal
  • Wordpress

Server Type

  • Vinahost

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Thaonguyenxanh.vn

SSL certificate

    • name: /OU=Domain Control Validated/OU=PositiveSSL Wildcard/CN=*.vinahost.vn
    • subject:
      • OU:
        • 0: Domain Control Validated
        • 1: PositiveSSL Wildcard
      • CN: *.vinahost.vn
    • hash: 7946195f
    • issuer:
      • C: GB
      • ST: Greater Manchester
      • L: Salford
      • O: COMODO CA Limited
      • CN: COMODO RSA Domain Validation Secure Server CA
    • version: 2
    • serialNumber: 190866620037383189971861831135667582871
    • validFrom: 150629000000Z
    • validTo: 160628235959Z
    • validFrom_time_t: 1435536000
    • validTo_time_t: 1467158399
    • extensions:
      • authorityKeyIdentifier: keyid:90:AF:6A:3A:94:5A:0B:D8:90:EA:12:56:73:DF:43:B4:3A:28:DA:E7
      • subjectKeyIdentifier: E1:E4:89:C2:6D:89:47:A4:55:B1:0B:50:A5:B2:7A:C1:61:EA:31:F7
      • keyUsage: Digital Signature, Key Encipherment
      • basicConstraints: CA:FALSE
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • certificatePolicies: Policy: 1.3.6.1.4.1.6449.1.2.2.7 CPS: https://secure.comodo.com/CPS Policy: 2.23.140.1.2.1
      • crlDistributionPoints: Full Name: URI:http://crl.comodoca.com/COMODORSADomainValidationSecureServerCA.crl
      • authorityInfoAccess: CA Issuers - URI:http://crt.comodoca.com/COMODORSADomainValidationSecureServerCA.crt OCSP - URI:http://ocsp.comodoca.com
      • subjectAltName: DNS:*.vinahost.vn, DNS:vinahost.vn

Meta - Thaonguyenxanh.vn

Number of occurences: 2
  • Name:
    Content:
  • Name: generator
    Content: WordPress 4.3.3

Server / Hosting

  • IP: 210.211.122.243
  • Latitude: 21.03
  • Longitude: 105.85
  • Country: Vietnam
  • City: Hanoi

Rname

  • ns1.matbao.vn
  • ns2.matbao.vn

Target

  • admin.matbao.com

HTTP Header Response

HTTP/1.1 200 OK Server: Vinahost Date: Sun, 17 Apr 2016 04:00:33 GMT Content-Type: text/html; charset=UTF-8 Connection: keep-alive X-Pingback: http://thaonguyenxanh.vn/xmlrpc.php

DNS

host: thaonguyenxanh.vn
  1. class: IN
  2. ttl: 3598
  3. type: A
  4. ip: 210.211.122.243
host: thaonguyenxanh.vn
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns1.matbao.vn
host: thaonguyenxanh.vn
  1. class: IN
  2. ttl: 3600
  3. type: NS
  4. target: ns2.matbao.vn
host: thaonguyenxanh.vn
  1. class: IN
  2. ttl: 3600
  3. type: SOA
  4. mname: ns1.matbao.vn
  5. rname: admin.matbao.com
  6. serial: 2015111205
  7. refresh: 7200
  8. retry: 1800
  9. expire: 1209600
  10. minimum-ttl: 3600

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.haonguyenxanh.vn, www.tqhaonguyenxanh.vn, www.qhaonguyenxanh.vn, www.tahaonguyenxanh.vn, www.ahaonguyenxanh.vn, www.t haonguyenxanh.vn, www. haonguyenxanh.vn, www.twhaonguyenxanh.vn, www.whaonguyenxanh.vn, www.tehaonguyenxanh.vn, www.ehaonguyenxanh.vn, www.tzhaonguyenxanh.vn, www.zhaonguyenxanh.vn, www.txhaonguyenxanh.vn, www.xhaonguyenxanh.vn, www.tchaonguyenxanh.vn, www.chaonguyenxanh.vn, www.taonguyenxanh.vn, www.theaonguyenxanh.vn, www.teaonguyenxanh.vn, www.thdaonguyenxanh.vn, www.tdaonguyenxanh.vn, www.thcaonguyenxanh.vn, www.tcaonguyenxanh.vn, www.thuaonguyenxanh.vn, www.tuaonguyenxanh.vn, www.thjaonguyenxanh.vn, www.tjaonguyenxanh.vn, www.thaonguyenxanh.vn, www.taonguyenxanh.vn, www.thbaonguyenxanh.vn, www.tbaonguyenxanh.vn, www.thgaonguyenxanh.vn, www.tgaonguyenxanh.vn, www.thonguyenxanh.vn, www.thaoonguyenxanh.vn, www.thoonguyenxanh.vn, www.thaponguyenxanh.vn, www.thponguyenxanh.vn, www.tha9onguyenxanh.vn, www.th9onguyenxanh.vn, www.thaonguyenxanh.vn, www.thonguyenxanh.vn, www.thaionguyenxanh.vn, www.thionguyenxanh.vn, www.thauonguyenxanh.vn, www.thuonguyenxanh.vn, www.thanguyenxanh.vn, www.thaobnguyenxanh.vn, www.thabnguyenxanh.vn, www.thaohnguyenxanh.vn, www.thahnguyenxanh.vn, www.thaognguyenxanh.vn, www.thagnguyenxanh.vn, www.thaojnguyenxanh.vn, www.thajnguyenxanh.vn, www.thaomnguyenxanh.vn, www.thamnguyenxanh.vn, www.thao nguyenxanh.vn, www.tha nguyenxanh.vn, www.thaovnguyenxanh.vn, www.thavnguyenxanh.vn, www.thaoguyenxanh.vn, www.thaonnguyenxanh.vn, www.thaonguyenxanh.vn, www.thaonhguyenxanh.vn, www.thaohguyenxanh.vn, www.thaonjguyenxanh.vn, www.thaojguyenxanh.vn, www.thaonkguyenxanh.vn, www.thaokguyenxanh.vn, www.thaonlguyenxanh.vn, www.thaolguyenxanh.vn, www.thaon guyenxanh.vn, www.thao guyenxanh.vn, www.thaonuyenxanh.vn, www.thaongsuyenxanh.vn, www.thaonsuyenxanh.vn, www.thaongxuyenxanh.vn, www.thaonxuyenxanh.vn, www.thaongyuyenxanh.vn, www.thaonyuyenxanh.vn, www.thaonghuyenxanh.vn, www.thaonhuyenxanh.vn, www.thaongnuyenxanh.vn, www.thaonnuyenxanh.vn, www.thaongcuyenxanh.vn, www.thaoncuyenxanh.vn, www.thaongduyenxanh.vn, www.thaonduyenxanh.vn, www.thaongeuyenxanh.vn, www.thaoneuyenxanh.vn, www.thaongruyenxanh.vn, www.thaonruyenxanh.vn, www.thaongtuyenxanh.vn, www.thaontuyenxanh.vn, www.thaongbuyenxanh.vn, www.thaonbuyenxanh.vn, www.thaongvuyenxanh.vn, www.thaonvuyenxanh.vn, www.thaongyenxanh.vn, www.thaonguwyenxanh.vn, www.thaongwyenxanh.vn, www.thaongueyenxanh.vn, www.thaongeyenxanh.vn, www.thaongusyenxanh.vn, www.thaongsyenxanh.vn, www.thaonguayenxanh.vn, www.thaonguenxanh.vn, www.thaonguyzenxanh.vn, www.thaonguzenxanh.vn, www.thaonguyaenxanh.vn, www.thaonguaenxanh.vn, www.thaonguysenxanh.vn, www.thaongusenxanh.vn, www.thaonguydenxanh.vn, www.thaongudenxanh.vn, www.thaonguyenxanh.vn, www.thaonguenxanh.vn, www.thaonguycenxanh.vn, www.thaongucenxanh.vn, www.thaonguy enxanh.vn, www.thaongu enxanh.vn, www.thaonguynxanh.vn, www.thaonguyexnxanh.vn, www.thaonguyxnxanh.vn, www.thaonguyesnxanh.vn, www.thaonguysnxanh.vn, www.thaonguyewnxanh.vn, www.thaonguywnxanh.vn, www.thaonguyernxanh.vn, www.thaonguyrnxanh.vn, www.thaonguyefnxanh.vn, www.thaonguyfnxanh.vn, www.thaonguyevnxanh.vn, www.thaonguyvnxanh.vn, www.thaonguyecnxanh.vn, www.thaonguycnxanh.vn, www.thaonguyeqnxanh.vn, www.thaonguyqnxanh.vn, www.thaonguyeanxanh.vn, www.thaonguyanxanh.vn, www.thaonguyeynxanh.vn, www.thaonguyynxanh.vn, www.thaonguyexanh.vn, www.thaonguyennxanh.vn, www.thaonguyenxanh.vn, www.thaonguyenhxanh.vn, www.thaonguyehxanh.vn, www.thaonguyenjxanh.vn, www.thaonguyejxanh.vn, www.thaonguyenkxanh.vn, www.thaonguyekxanh.vn, www.thaonguyenlxanh.vn, www.thaonguyelxanh.vn, www.thaonguyen xanh.vn, www.thaonguye xanh.vn, www.thaonguyenanh.vn, www.thaonguyenxqanh.vn, www.thaonguyenqanh.vn, www.thaonguyenxanh.vn, www.thaonguyenanh.vn, www.thaonguyenxaanh.vn, www.thaonguyenaanh.vn, www.thaonguyenxsanh.vn, www.thaonguyensanh.vn, www.thaonguyenxdanh.vn, www.thaonguyendanh.vn, www.thaonguyenxeanh.vn, www.thaonguyeneanh.vn,

Other Reviews

  1. The Windsor Dental Center with Dr. Steven P. Stern
    Dr. Steven Stern of Windsor Dental Center is a professional dedicated to Excellence in General, Family, & Cosmetic Dentistry such as Dental Makeovers, Porcelain Veneers, Teeth Whitening, Crowns/Caps & many other dental procedures. Please come and visit Windsor Dental Center, in New Windsor, NY.
    United States - 8.19.178.140
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, jQuery, jQuery Cookie, Php, Google Analytics
    Number of Javascript: 12
    Number of meta tags: 6
  2. GABLESCLUB
    Englewood (United States) - 204.200.222.174
    Server software: Apache/1.3.42 Ben-SSL/1.60 (Unix) mod_perl/1.30 FrontPage/5.0.2.2624
    Technology: Html
    Number of meta tags: 1
  3. emergencyrepairandweldingservice.com - Portable Rig Welding Services
    Portable Rig Welding Services
    Burnaby (Canada) - 69.161.143.73
    G Analytics ID: UA-52100612-1
    Server software: Apache
    Technology: CSS, Html, Javascript, Google Analytics
    Number of meta tags: 6
  4. Art Fusion Möbel
    Shop powered by PrestaShop
    Germany - 81.169.145.93
    G Analytics ID: UA-58828347-1
    Server software: Apache/2.2.15 (CentOS)
    Technology: CSS, Flexslider, Google Font API, Html, Html5, Javascript, Google Analytics
    Number of Javascript: 22
    Number of meta tags: 8
  5. artismundus.com
    New York (United States) - 69.172.201.153
    Server software: DOSarrest
    Technology: Html, Javascript
    Number of meta tags: 1
  6. Barbara Koedel Fotografie
    Germany - 217.160.233.77
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 1
  7. QUBE - Better Buildings
    QUBE - Better Buildings
    Provo (United States) - 69.89.31.141
    Server software: nginx/1.10.1
    Technology: AJAX Libraries API, CSS, Html, Html5, Javascript, jQuery Cycle, Google Analytics
    Number of Javascript: 3
    Number of meta tags: 4
  8. The Ultimate Source of Telecommunication Products and Services -
    Scottsdale (United States) - 50.63.111.1
    Server software: Apache
    Technology: CSS, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
    Number of Javascript: 17
    Number of meta tags: 6
  9. Boardreader - Forum Search Engine
    Boardreader is search engine for Forums and Boards. Get fast and quality search for your own forum.
    Troy (United States) - 208.92.218.173
    Server software: Apache
    Technology: CSS, Html, Javascript, Php, Pingdom
    Number of Javascript: 5
    Number of meta tags: 3